Recombinant HSP65 Protein
Beta LifeScience
SKU/CAT #: BLA-3812P
Recombinant HSP65 Protein
Beta LifeScience
SKU/CAT #: BLA-3812P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mycobacterium bovis |
Accession | Q1EHB9 |
Description | Recombinant HSP65 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | EDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGAN PLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLIA EAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEA VLEDPYILLVSSKVSTVKDLLPLXXXXXXXGKPLLIIAEDVEGEALSTLV |
Molecular Weight | 65 kDa |
Purity | >90% SDS-PAGE.Purified by multi-step processing. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. |