Recombinant HPV18 E7 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11482P
Recombinant HPV18 E7 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-11482P
Collections: Featured viral antigens molecules, Hpv, Recombinant proteins, Viral antigen
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Accession | P06788 |
Synonym | E7 protein Human Papilloma Virus Type 18 E7 protein |
Description | Recombinant HPV18 E7 Protein (His tag) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLP ARRAEPQRHTMLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPW CASQQ |
Molecular Weight | 12 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta). |
Subcellular Location | Host cytoplasm. Host nucleus. |
Protein Families | Papillomaviridae E7 protein family |