Recombinant horse IL5 Protein
Beta LifeScience
SKU/CAT #: BLA-0911P
Recombinant horse IL5 Protein
Beta LifeScience
SKU/CAT #: BLA-0911P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Equus |
Accession | O02699 |
Synonym | B-cell differentiation factor I Colony stimulating factor EDF Eosinophil differentiation factor IL-5 IL5 IL5_HUMAN Interleukin 5 Interleukin 5 (colony stimulating factor, eosinophil) Interleukin-5 T Cell Replacing Factor T-cell replacing factor TRF |
Description | Recombinant horse IL5 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | AVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNHQLCIEEVFQG IDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQ EFLGVINTEWTIEG |
Molecular Weight | 13 kDa |
Purity | >95% SDS-PAGE.Purified by ion-exchange chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The biological activity of recombinant equine IL-5 was measured in a cell proliferation assay using the human TF-1 cell line. The ED50 for this effect is typically 20 - 30 ng/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |