Recombinant horse IL15 Protein
Beta LifeScience
SKU/CAT #: BLA-0907P
Recombinant horse IL15 Protein
Beta LifeScience
SKU/CAT #: BLA-0907P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Equus |
Accession | NP_001157458.1 |
Synonym | IL 15 IL-15 IL15 IL15_HUMAN Interleukin 15 Interleukin-15 Interleukin15 MGC9721 |
Description | Recombinant horse IL15 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | NWQDVISDLKRIEDLIQSIHVDATLYTESDAHPNCKVTAMKCFLLELHVI SHESRNEDIKETVENLIILANSSLSSNGNVTESGCKECEELEEKNIKEFL QSFVHIVQMFINPS |
Molecular Weight | 13 kDa |
Purity | >95% SDS-PAGE.Purified by ion-exchange chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The biological activity of ab87902 was measured in a cell proliferation assay using CTLL2 mouse cytotoxic T cells. The ED50 for this effect is typically 50 - 75 ng/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycle. |