Recombinant Horse IL1 beta Protein
Beta LifeScience
SKU/CAT #: BLA-0902P
Recombinant Horse IL1 beta Protein
Beta LifeScience
SKU/CAT #: BLA-0902P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Equus |
Accession | Q28386 |
Synonym | Catabolin H1 IFN beta inducing factor IL 1 IL 1 beta IL-1 beta IL1 IL1 BETA IL1B IL1B_HUMAN IL1F2 Interleukin 1 beta Interleukin 1 beta precursor interleukin 1, beta Interleukin-1 beta OAF Osteoclast activating factor OTTHUMP00000162031 Preinterleukin 1 beta Preinterleukin beta Pro interleukin 1 beta |
Description | Recombinant Horse IL1 beta Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | AAVHSVNCRLRDIYHKSLVLSGACELQAVHLNGENTNQQVVFCMSFVQGE EETDKIPVALGLKEKNLYLSCGMKDGKPTLQLETVDPNTYPKRKMEKRFV FNKMEIKGNVEFESAMYPNWYISTSQAEKKPVFLGNTRGGRDITDFIMEI TSA |
Molecular Weight | 17 kDa |
Purity | >95% SDS-PAGE.Purified by Ion-exchange chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. |
Subcellular Location | Cytoplasm, cytosol. Lysosome. Secreted, extracellular exosome. Secreted. |
Protein Families | IL-1 family |
Database References |
Gene Functions References
- Increased PGE2 production led to reduction in 5-LO products in LPS-treated equine whole blood via IL-1b. PMID: 24530239
- Results suggested that chemokine expression by cultured equine BECs following exposure to pulmonary hemorrhage conditions may contribute to the development of inflammatory airway disease in horses. PMID: 22280393
- IL-1beta-induced up-regulation of matrix metalloproteinase 13 mRNA was blocked by all concentrations of geldanamycin tested PMID: 17599753
- This study examined effects of in vitro exposure to solutions of hay dust, lipopolysaccharides, or beta-glucan on cytokine expression in pulmonary mononuclear cells isolated from healthy horses and horses with recurrent airway obstruction. PMID: 18052742
- The effects of semen extender and seminal plasma on the expression of inflammatory modulators in the endometrium of mares are reported. PMID: 18584861
- The acute pulmonary neutrophilia characteristic of recurrent airway obstruction was not associated with an increase in expression of chemokines in pulmonary mononuclear cells from disease-susceptible horses. PMID: 19795943