USA  Tel: 1-201-888-7983
Email: info@betalifesci.com

Recombinant HIV1 gp120 Protein

Cat No.: BLA-11303P
Description Related products
accession P04578
synonym Glycoprotein 120 gp120 SU Surface protein
description Recombinant HIV1 gp120 Protein was expressed in Baculovirus infected insect cells. It is a Full length protein
source Baculovirus infected insect cells
AA sequence KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQ EVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLK CTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYK LDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAIL KCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRS VNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIG NMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIV THSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRI KQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIF RPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR
molecular weight 54 kDa
purity >90% SDS-PAGE.Purified under conditions that maintain the tertiary structure of the molecule. Sterile filtered solution.
endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
formulation Liquid Solution
stability The recombinant protein samples are stable for up to 12 months at -80℃
reconstitution See related COA
unit definition For Research Use Only
storage buffer Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.
Online Inquiry
For quote, please fill in the online form or send email to info@betalifesci.com.
$50 Coupon