Recombinant Hepatitis C Virus Core 2a Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11362P
Recombinant Hepatitis C Virus Core 2a Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-11362P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Accession | FJ393024 |
Synonym | Genome polyprotein HCV 2a HCV core 2a HCV Core genotype 2a HCV2a Hepatitis C Virus Core genotype 2a |
Description | Recombinant Hepatitis C Virus Core 2a Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MDYKDDDDKHHHHHHGCVSIIGRLHVNGSGSITAYAQQTRGLLGAIVVSM TGRDRTEQAGEVQILSTVSQSFLGTTISGVLWTVYHGAGNKTLAGLRGPV TQMYSSAEGDLVGWPSPPGTKSLEPCKCGAVDLYLVTRNADVIPARRRGD KRGALLSPRPISTLKGSSGGPVLCPRGHVVGLFRAAVCSRGVAKSIDFIP VETLDVVTRS |
Molecular Weight | 22 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific Activity: 93 pmole/min/μgAssay conditions: Assay was done in 100 μl HCV assay buffer containing 50 mM Tris, pH7.4, 150 mM NaCl, 5 mM DTT, 10% glycerol, and 5 μM HCV substrate peptide. Reaction was monitored at room temperature for 20 min continuously at ex350/em500. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |