Recombinant E. coli heat labile toxin A Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3663P
Recombinant E. coli heat labile toxin A Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3663P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Escherichia coli |
Accession | P06717 |
Synonym | eltA Escherichia coli Heat labile enterotoxin A subunit LTP A |
Description | Recombinant E. coli heat labile toxin A Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQT GFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDV LGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYY RNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCN EETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL |
Molecular Weight | 33 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase. |
Protein Families | Enterotoxin A family |