Recombinant E. coli ftsZ Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3673P
Recombinant E. coli ftsZ Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3673P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Escherichia coli |
Accession | P0A9A7 |
Description | Recombinant E. coli ftsZ Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALR KTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFI AAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGI TELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELI TRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLE DIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDP DMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQE QKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD |
Molecular Weight | 56 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity. |
Subcellular Location | Cytoplasm. |
Protein Families | FtsZ family |
Database References | KEGG: ecc:c0113 STRING: 199310.c0113 |