Recombinant E. coli Cytolethal distending toxin subunit B Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3654P
Recombinant E. coli Cytolethal distending toxin subunit B Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3654P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Escherichia coli |
Accession | Q46669 |
Synonym | CDT B cdtB Deoxyribonuclease CdtB |
Description | Recombinant E. coli Cytolethal distending toxin subunit B Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPS TAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLAL VSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVE EVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPA AATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSR R |
Molecular Weight | 47 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Part of the tripartite complex that is required for the CDT activity. CdtB exhibits a DNA-nicking endonuclease activity, and very probably causes DNA damage in intoxicated cells. This damage induces G2/M cell cycle arrest, chromatin fragmentation, cell distention and nucleus enlargement. |
Subcellular Location | Secreted. Note=Localized to the nucleus of the infected cells. |