Recombinant E. coli Carbonic anhydrase 2/CA2 Protein
Beta LifeScience
SKU/CAT #: BLA-3650P
Recombinant E. coli Carbonic anhydrase 2/CA2 Protein
Beta LifeScience
SKU/CAT #: BLA-3650P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Escherichia coli |
Accession | P61517 |
Synonym | CA 2 CA II CA-II Ca2 CAC CAH2_HUMAN CAII Car 2 Car2 Carbonate dehydratase II Carbonic anhydrase 2 Carbonic anhydrase B Carbonic anhydrase C Carbonic anhydrase C, formerly Carbonic anhydrase II Carbonic dehydratase epididymis luminal protein 76 Epididymis secretory protein Li 282 HEL-76 HEL-S-282 |
Description | Recombinant E. coli Carbonic anhydrase 2/CA2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMKDIDTLISNNALWSKMLVEEDPGFFEKLA QAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSV VQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKH SSLLGEMPQERRLDTLCELNVMEQVYNLGHSTIMQSAWKRGQKVTIHGWA YGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK |
Molecular Weight | 27 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific activity is > 1,000 pmol/min/ug, and is defined as the amount of enzyme that hydrolyze 1.0 pmole of 4-nitrophenyl acetate to 4-nitrophenol per minute at pH 7.5 at 37C. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |