Recombinant E. coli Beta-lactamase CTX-M-1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3646P
Recombinant E. coli Beta-lactamase CTX-M-1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3646P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Escherichia coli |
Accession | P28585 |
Synonym | bla |
Description | Recombinant E. coli Beta-lactamase CTX-M-1 Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVM AVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAA ALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPG DPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGL PASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRD VLASAAKIVTNGL |
Molecular Weight | 32 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins. |
Protein Families | Class-A beta-lactamase family |
Database References | KEGG: ag:CAA63262 |