Recombinant E. coli AGMAT Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3641P
Recombinant E. coli AGMAT Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3641P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Escherichia coli |
Accession | B7LFJ6 |
Synonym | 5033405N08Rik Agmatinase Agmatinase mitochondrial Agmatine ureohydrolase AUH FLJ23384 OTTMUSP00000010524 RP23-395H4.1 |
Description | Recombinant E. coli AGMAT Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRA GGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDARE MSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDA HTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDIDNGFTVLD ACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGL TSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ AAKKGE |
Molecular Weight | 50 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Catalyzes the formation of putrescine from agmatine. |
Protein Families | Arginase family, Agmatinase subfamily |
Database References | KEGG: eck:EC55989_3229 |