Recombinant dog IL8 Protein
Beta LifeScience
SKU/CAT #: BLA-0880P
Recombinant dog IL8 Protein
Beta LifeScience
SKU/CAT #: BLA-0880P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Dog |
Accession | P41324 |
Synonym | (Ala-IL-8)77 (Ser-IL-8)72 9E3 Beta thromboglobulin like protein C-X-C motif chemokine 8 CEF-4 chemokine, CXC motif, ligand 8 CXCL8 Emoctakin GCP-1 GCP/IL-8 protein I GCP/IL-8 protein II GCP/IL-8 protein III GCP/IL-8 protein IV GCP/IL-8 protein V GCP/IL-8 protein VI GCP1 Granulocyte chemotactic protein 1 IL-8 IL-8(1-77) IL-8(9-77) IL8 IL8/NAP1 form I IL8/NAP1 form II IL8/NAP1 form III IL8/NAP1 form IV IL8/NAP1 form V IL8/NAP1 form VI IL8_HUMAN Inteleukin 8 LECT LUCT Lymphocyte-derived neutrophil-activating factor LYNAP MDNCF MDNCF-b MDNCF-c MONAP Monocyte derived neutrophil activating peptide Monocyte derived neutrophil chemotactic factor Monocyte-derived neutrophil chemotactic factor Monocyte-derived neutrophil-activating peptide NAF NAP 1 NAP-1 NAP1 Neutrophil activating peptide 1 Neutrophil activating protein 1 Neutrophil-activating factor Neutrophil-activating protein 1 Protein 3 10C Protein 3-10C SCYB 8 SCYB8 Small inducible cytokine subfamily B member 8 T cell chemotactic factor T-cell chemotactic factor TSG 1 TSG1 |
Description | Recombinant dog IL8 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFN GNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
Molecular Weight | 9 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The biological activity was determined by a chemotaxis bioassay using Human CXCR2 transfected murine BaF3 cells is in a concentration range of 0.15-0.75 ng/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. |
Target Details
Target Function | IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. |
Subcellular Location | Secreted. |
Protein Families | Intercrine alpha (chemokine CxC) family |
Database References |
Gene Functions References
- Analysis of ROC suggests the use of serum levels of MCP-1 and IL-7 as predictors of the occurrence of complications with an AUC of 0.906 and 0.896 respectively and linear combinations of MCP-1, KC-Like, IL-7 and GM-CSF with values up to AUC = 0.983 PMID: 29304171
- These observations indicate that the individual activation of ERK2 and JNK1 pathways contributes to TNF-alpha-induced IL-8 expression in synovial fibroblasts. PMID: 28806729
- data suggest that CCL2 acts as a PMNs chemotactic factor as well as CXCL8, and both CCL2 and CXCL8 facilitate the infiltration of PMNs into the joints of idiopathic polyarthritis PMID: 27863550
- The study findings suggest that both CCL2 and CXCL8 are involved in the pathogenesis of canine idiopathic pulmonary fibrosis. PMID: 26231926
- High CXCL8 blood concentrations might be related to the breed predisposition of the West Highland white terrier for canine idiopathic pulmonary fibrosis. PMID: 26267090
- IL-8-positive macrophages were significantly increased in large polyps compared to controls PMID: 24148828
- hemangiosarcoma derived IL-8 may play a role in tumor development by modulating the tumor microenvironment PMID: 24582862
- Data indicate that the Leishmania braziliensis antigens plus saponin (LBSap) vaccine induced high levels of IL-12, IL-10, CCL4, CCL5 and CXCL8 expression within 48 hours. PMID: 23911411
- serum and tumor levels of IL-8 and IL-10 in dogs bearing benign and malignant mammary tumors, including dogs with inflammatory mammary cancer, for a better understanding of this disease PMID: 23351639
- Sixty-one percent (28/46) of the samples from canine stifle osteoarthritis had IL-8 mRNA expression in contrast to 4% (1/24) in the control stifle joints PMID: 16102844
- Adipose tissue-derived mesenchymal stem cells expressed the mRNA of transforming growth factor beta (TGF-beta), IL-6, IL-8, CCL2, CCL5, VEGF,HGF, tissue inhibitor metalloproteinase-1/2, and cyclooxygenase-2 but not that of IL-10. PMID: 18717642