Recombinant dog IL4 Protein
Beta LifeScience
SKU/CAT #: BLA-0874P
Recombinant dog IL4 Protein
Beta LifeScience
SKU/CAT #: BLA-0874P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Dog |
Accession | O77762 |
Synonym | B cell growth factor 1 B cell IgG differentiation factor B Cell Stimulatory Factor 1 B-cell stimulatory factor 1 BCGF 1 BCGF1 Binetrakin BSF-1 BSF1 IGG1 induction factor IL 4 IL-4 IL4 IL4_HUMAN Il4e12 Interleukin 4 Interleukin 4 variant 2 Interleukin 4, isoform 1 Interleukin-4 Lymphocyte stimulatory factor 1 MGC79402 Pitrakinra |
Description | Recombinant dog IL4 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MHNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAA TVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKV IMQKKYYRH |
Molecular Weight | 13 kDa |
Purity | >95% SDS-PAGE.Produced using animal-free processes and contains only animal-free raw materials. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | TF-1 cell proliferation: ED50 -‰¤ 25 ng/mL (-‰¥ 4.0 x 104 units/mg). |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at room temperature. Store at -20°C. |
Target Details
Target Function | Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4. |
Subcellular Location | Secreted. |
Protein Families | IL-4/IL-13 family |
Database References |
Gene Functions References
- immunoreactivities of inflammatory cytokines, such as interleukin (IL)-2, its receptor (IL-2R), IL-4 and its receptor (IL-4R) in the cervical and lumbar spinal cord of young adult and aged beagle dogs, were compared. PMID: 23605681
- In dogs with leishmaniasis, there was high expression of genes encoding IL-4 in blood leucocytes. The predominance of IL-4 gene expression in the blood of asymptomatic dogs may favour parasite replication. PMID: 21511273
- The anti-inflammatory and anabolic effects of regulated expression of IL-4 in chondrocyte-scaffolds under in vitro inflammatory conditions, were investigated. PMID: 21991344
- This study focuses on the co-expression of interleukin-4 (IL-4) and insulin-like-growth factor-1 (IGF-1), which specifically target inflammation and cartilage repair, respectively. PMID: 20188584
- These findings suggest that polyunsaturated fatty acids are able to influence proliferation of peripheral blood mononuclear cells in healthy and atopic dogs but do not seem to influence cytokine transcription. PMID: 20187917
- IL-4 expressed in canine articular chondrocytes is biologically active and suppresses inflammatory mediators in vitro. PMID: 18789870