Recombinant dog IL3 Protein
Beta LifeScience
SKU/CAT #: BLA-0873P
Recombinant dog IL3 Protein
Beta LifeScience
SKU/CAT #: BLA-0873P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Dog |
Accession | Q9BDX4 |
Synonym | Colony stimulating factor multiple Hematopoietic growth factor IL 3 IL-3 IL3 IL3_HUMAN Interleukin 3 Interleukin 3 (colony stimulating factor, multiple) Interleukin-3 Mast cell growth factor MCGF MGC79398 MGC79399 Multi CSF Multilineage colony stimulating factor Multipotential colony stimulating factor Multipotential colony-stimulating factor OTTHUMP00000065963 P cell stimulating factor P-cell-stimulating factor |
Description | Recombinant dog IL3 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPN LDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQ RKLKKYLEALDNFLNFKNKP |
Molecular Weight | 14 kDa |
Purity | >97% SDS-PAGE.> 97 % by HPLC. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The ED50 as determined by the dose-dependant stimulation of the proliferation of Human TF-1 cells is less than 0.2 ng/ml, corresponding to a specific activity of 5.0x106 IU/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |