Recombinant dog IL2 Protein
Beta LifeScience
SKU/CAT #: BLA-0870P
Recombinant dog IL2 Protein
Beta LifeScience
SKU/CAT #: BLA-0870P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Dog |
Accession | Q29416 |
Synonym | Aldesleukin IL 2 IL-2 IL2 IL2_HUMAN Interleukin 2 Interleukin-2 interleukin2 Involved in regulation of T cell clonal expansion Lymphokine OTTHUMP00000164090 POIL2 T Cell Growth Factor T-cell growth factor TCGF |
Description | Recombinant dog IL2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MAPITSSSTKETEQQMEQLLLDLQLLLNGVNNYENPQLSRMLTFKFYTPK KATEFTHLQCLAEELKNLEEVLGLPQSKNVHLTDTKELISNMNVTLLKLK GSETSYNCEYDDETATITEFLNKWITFSQSIFSTLT |
Molecular Weight | 16 kDa |
Purity | >95% SDS-PAGE.Produced using animal-free processes and contains only animal-free raw materials. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | CTLL-2 cell proliferation: ED50 -‰¤ 5 ng/mL (-‰¥ 2.0 x 105 units/mg) |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. Store at -20°C or -80°C. |