Recombinant Dog IL13 Protein
Beta LifeScience
SKU/CAT #: BLA-0864P
Recombinant Dog IL13 Protein
Beta LifeScience
SKU/CAT #: BLA-0864P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Dog |
Accession | Q9N0W9 |
Synonym | Allergic rhinitis ALRH BHR 1 BHR1 Bronchial hyperresponsiveness 1 (bronchial asthma) IL 13 IL-13 Il13 IL13_HUMAN Interleukin 13 Interleukin-13 interleukin13 MGC116786 MGC116788 MGC116789 NC 30 NC30 P 600 P600 |
Description | Recombinant Dog IL13 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALES LINVSDCSAIQRTQRMLKALCSQKPAAGISSERSRDTKIEVIQLVKNLLT YVRGVYRHGNFR |
Molecular Weight | 12 kDa |
Purity | >95% SDS-PAGE.Ion-exchange chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages. |
Subcellular Location | Secreted. |
Protein Families | IL-4/IL-13 family |
Database References |