Recombinant dog GM-CSF Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-1827P
Recombinant dog GM-CSF Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-1827P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Dog |
Accession | P48749 |
Synonym | Colony stimulating factor Colony Stimulating Factor 2 Colony stimulating factor 2 (granulocyte-macrophage) Colony-stimulating factor CSF CSF 2 CSF2 CSF2_HUMAN GM-CSF GMCSF Granulocyte Macrophage Colony Stimulating Factor Granulocyte-macrophage colony-stimulating factor MGC131935 MGC138897 MGI1GM Molgramostin Pluripoietin-a Sargramostim |
Description | Recombinant dog GM-CSF Protein (Animal Free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MAPTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDP EGPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQ NINFKSFKENLKDFLFNIPFDCWKPVKK |
Molecular Weight | 14 kDa |
Purity | >= 95% SDS-PAGE.Produced using animal-free processes and contains only animal-free raw materials. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | TF-1 cell proliferation: ED50 -‰¤ 15 ng/ml ( -‰¥ 6.7 x 104 units/mg). |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. |