Recombinant DNA protection during starvation Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3615P
Recombinant DNA protection during starvation Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3615P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mycobacterium smegmatis |
Accession | P0C558 |
Synonym | Bacterioferritin dps HP-NAP NAP A napA Neutrophil-activating protein A |
Description | Recombinant DNA protection during starvation Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MTSFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGV HEMIDPQVELVRGYADEVAERIATLGKSPKGTPGAIIKDRTWDDYSVERD TVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIAHAGELEKFQW FVRAHLESAGGQLTHEGQSTEKGAADKARRKSA |
Molecular Weight | 36 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Protects DNA from oxidative damage by sequestering intracellular Fe(2+) ion and storing it in the form of Fe(3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe(2+) ions, which prevents hydroxyl radical production by the Fenton reaction. It protects DNA from hydroxyl radical-mediated cleavage. Binds DNA with no apparent sequence specificity without self-aggregation nor promotion of DNA condensation. Is unable to protect DNA from DNase-mediated cleavage. |
Subcellular Location | Cytoplasm, nucleoid. |
Protein Families | Dps family |