Recombinant Dihydroxyacetone kinase Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3606P
Recombinant Dihydroxyacetone kinase Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3606P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Citrobacter freundii |
Accession | P45510 |
Description | Recombinant Dihydroxyacetone kinase Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | ALVAGIVELVTATLSDLETHLNALDAKVGDGDTGSTFAAAAREIASLLHR QQLPLNNLATLFALIGERLTVVMGGSSGVLMSIFFTAAGQKLEQGANVVE ALNTGLAQMKFYGGADEGDRTMIDALQPALTSLLAQPKNLQAAFDAAQAG AERTCLSSKANAGRASYLSSESLLGNMDPGAQRLAMVFKALAE |
Molecular Weight | 36 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Catalyzes the phosphorylation of dihydroxyacetone. |