Recombinant cynomolgus monkey TIM-3 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-10754P
Recombinant cynomolgus monkey TIM-3 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-10754P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cynomolgus monkey |
Accession | G7P6Q7 |
Synonym | CD366 FLJ14428 HAVcr-2 Havcr2 HAVR2_HUMAN Hepatitis A virus cellular receptor 2 Kidney injury molecule 3 KIM 3 KIM3 T cell immunoglobulin and mucin domain containing 3 T cell immunoglobulin mucin 3 T-cell immunoglobulin and mucin domain-containing protein 3 T-cell immunoglobulin mucin family member 3 T-cell immunoglobulin mucin receptor 3 T-cell membrane protein 3 Tim 3 TIM-3 TIM3 TIMD-3 TIMD3 |
Description | Recombinant cynomolgus monkey TIM-3 Protein (Fc Tag Active) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | SEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTD NRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMND EKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLP DVNLTVSNFFCELQIFTLTNELRDSGATIR |
Molecular Weight | 46 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized protein at 2 μg/ml (100 μl/well)can bind Anti-TIM 3 mAb, Human IgG4 with a linear range of 0.5 - 4 ng/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |