Recombinant cynomolgus monkey PD-L1 Protein
Beta LifeScience
SKU/CAT #: BLA-10749P
Recombinant cynomolgus monkey PD-L1 Protein
Beta LifeScience
SKU/CAT #: BLA-10749P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cynomolgus monkey |
Accession | G7PSE7 |
Synonym | B7 H B7 H1 B7 homolog 1 B7-H1 B7H B7H1 CD 274 CD274 CD274 antigen CD274 molecule MGC142294 MGC142296 OTTHUMP00000021029 PD L1 PD-L1 PD1L1_HUMAN PDCD1 ligand 1 PDCD1L1 PDCD1LG1 PDL 1 PDL1 Programmed cell death 1 ligand 1 Programmed death ligand 1 RGD1566211 |
Description | Recombinant cynomolgus monkey PD-L1 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFV HGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISY GGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWT SSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEE NHTAELVIPELPLALPPNER |
Molecular Weight | 27 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized protein at 10 μg/mL (100 μl/well) can bind Cynomolgus PD-1, Fc Tag with a linear range of 0.6-10 μg/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |