Recombinant Cynomolgus monkey OX40L/TNFSF4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10748P
Recombinant Cynomolgus monkey OX40L/TNFSF4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10748P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cynomolgus monkey |
Synonym | CD 134L CD 252 CD134 ligand CD134L CD252 CD252 antigen glycoprotein 34 kd Glycoprotein Gp34 GP34 OX-40L OX40 antigen ligand OX40 ligand OX40L TAX transcriptionally-activated glycoprotein 1 TNFL4_HUMAN Tnfsf4 Tumor necrosis factor (ligand) superfamily member 4 Tumor necrosis factor ligand superfamily member 4 TXGP1 |
Description | Recombinant Cynomolgus monkey OX40L/TNFSF4 Protein (His tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | HHHHHHHHQVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNS VIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVAS LTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
Molecular Weight | 17 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |