Recombinant Cynomolgus monkey EPO Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1823P
Recombinant Cynomolgus monkey EPO Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1823P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cynomolgus monkey |
Accession | P07865 |
Synonym | EP EPO EPO alpha Epoetin Erythropoetin Erythropoietin precursor MVCD2 |
Description | Recombinant Cynomolgus monkey EPO Protein (His tag) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYA WKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAIS GLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRG KLKLYTGEACRRGDR |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3. |
Subcellular Location | Secreted. |
Protein Families | EPO/TPO family |
Database References | UniGene: Mfa.5395 |
Tissue Specificity | Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals. |