Recombinant Cynomolgus monkey 5T4 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3590P
Recombinant Cynomolgus monkey 5T4 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3590P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cynomolgus monkey |
Accession | Q4R8Y9 |
Synonym | 5T4 5T4 oncofetal antigen 5T4 oncofetal trophoblast glycoprotein 5T4 oncotrophoblast glycoprotein 5T4AG AW495680 M6P1 TPBG TPBG_HUMAN Trophoblast glycoprotein |
Description | Recombinant Cynomolgus monkey 5T4 Protein (Tagged) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | TSSASSSSSSAPFLASAASAQPPLPDQCPALCECSEAARTVKCVNRNLTE VPTDLPLYVRNLFLTGNQLAVLPAGAFARRPPLAELAALNLSGSRLDEVR GGAFEHLPSLRQLDLSHNPLAYLSPFAFSGSNASISAPSPLVELILNHIV PPDDKRQNRSFEGMVAAALVAGRALQGLHLLELASNHFLYLPRDVLAQLP SLRYLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGL PHVRVFLDNNPWVCDCHMADMVTWLKQTGVVQGKDRLTCAFPEKMRNRVL LELNSADLDCDPILPPSLQTS |
Molecular Weight | 40 kDa including tags |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Database References | KEGG: mcf:102132149 UniGene: Mfa.1408 |