Recombinant Chinese hamster NEU2 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3559P
Recombinant Chinese hamster NEU2 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3559P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Chinese hamster |
Accession | Q64393 |
Synonym | Cytosolic sialidase MGC129579 N acetyl alpha neuraminidase 2 N-acetyl-alpha-neuraminidase 2 Neu2 NEUR2_HUMAN Neuraminidase 2 OTTHUMP00000164374 SIAL2 Sialidase 2 Sialidase-2 |
Description | Recombinant Chinese hamster NEU2 Protein (Tagged) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHAD LFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFL FFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGST HQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSH DHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPN SGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDS RKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFG CLYESNNYEEIVFLMFTLKQAFPAVFGAQ |
Molecular Weight | 42 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Catalyzes the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides and gangliosides. |
Subcellular Location | Cytoplasm. |
Protein Families | Glycosyl hydrolase 33 family |
Database References | KEGG: cge:100689301 |