Recombinant Chinese hamster Cathepsin D Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3557P
Recombinant Chinese hamster Cathepsin D Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3557P
Collections: Enzymes, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Chinese hamster |
Accession | G3I4W7 |
Synonym | CatD CATD_HUMAN Cathepsin D Cathepsin D heavy chain CD Ceroid lipofuscinosis neuronal 10 CLN10 CPSD ctsd Epididymis secretory sperm binding protein Li 130P HEL S 130P Lysosomal aspartyl peptidase Lysosomal aspartyl protease MGC2311 |
Description | Recombinant Chinese hamster Cathepsin D Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLD IACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQ PGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNL MQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKA YWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAV PLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLS GFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL |
Molecular Weight | 53 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |