Recombinant Chicken CX3CL1 Protein
Beta LifeScience
SKU/CAT #: BLA-2135P
Recombinant Chicken CX3CL1 Protein
Beta LifeScience
SKU/CAT #: BLA-2135P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Chicken |
Accession | 415651 |
Synonym | A 152E5.2 AB030188 ABCD 3 ABCD3 AI848747 C-X3-C motif chemokine 1 C3Xkine Chemokine (C-X3-C motif) ligand 1 Chemokine C X3 C motif ligand 1 Chemokine CX3C Motif Ligand 1 CX3C membrane anchored chemokine CX3C membrane-anchored chemokine Cx3cl1 CXC 3 CXC3 CXC3C D8Bwg0439e FKN Fractalkine Neurotactin NTN NTT Processed fractalkine SCYD 1 SCYD1 Small inducible cytokine D1 Small inducible cytokine subfamily D (Cys X3 Cys) member 1 small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin) Small inducible cytokine subfamily D member 1 Small-inducible cytokine D1 X3CL1_HUMAN |
Description | Recombinant Chicken CX3CL1 Protein was expressed in Yeast. It is a Protein fragment |
Source | Yeast |
AA Sequence | QPRAPLKCSKWCISFHRAIDQRQIKSYRETEPQCTKKAIIFTTKRNREIC ANPYEPWVEKIVKKLD |
Molecular Weight | 8 kDa |
Purity | >95% SDS-PAGE.Purified by Ion-exchange chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |