Recombinant Cat IL4 Protein
Beta LifeScience
SKU/CAT #: BLA-0810P
Recombinant Cat IL4 Protein
Beta LifeScience
SKU/CAT #: BLA-0810P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cat |
Accession | P55030 |
Synonym | B cell growth factor 1 B cell IgG differentiation factor B Cell Stimulatory Factor 1 B-cell stimulatory factor 1 BCGF 1 BCGF1 Binetrakin BSF-1 BSF1 IGG1 induction factor IL 4 IL-4 IL4 IL4_HUMAN Il4e12 Interleukin 4 Interleukin 4 variant 2 Interleukin 4, isoform 1 Interleukin-4 Lymphocyte stimulatory factor 1 MGC79402 Pitrakinra |
Description | Recombinant Cat IL4 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | QNFNNTLKEIIKTLNILTARNDSCMELTVMDVLAAPKNTSDKEIFCRATT VLRQIYTHHNCSTKFLKGLDRNLSSMANRTCSVNEVKKCTLKDFLERLKA IMQKKYSKH |
Molecular Weight | 13 kDa |
Purity | >95% SDS-PAGE.Purified by ion-exchange chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |