Recombinant cat IL2 (mutated C146 S) Protein
Beta LifeScience
SKU/CAT #: BLA-0809P
Recombinant cat IL2 (mutated C146 S) Protein
Beta LifeScience
SKU/CAT #: BLA-0809P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Cat |
Accession | Q07885 |
Synonym | Aldesleukin IL 2 IL-2 IL2 IL2_HUMAN Interleukin 2 Interleukin-2 interleukin2 Involved in regulation of T cell clonal expansion Lymphokine OTTHUMP00000164090 POIL2 T Cell Growth Factor T-cell growth factor TCGF |
Description | Recombinant cat IL2 (mutated C146 S) Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSAPASSSTKETQQQLEQLLLDLRLLLNG VNNPENPKLSRMLTFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKN FHLNHIKELMSNINVTVLKLKGSETRFTCNYDDETATIVEFLNKWITFSQ SIFSTLT |
Molecular Weight | 18 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured in a cell proliferation assay using CTLL2 mouse cytotoxic T cells. The ED50 for this effect is less or equal to 0.3 ng/ml. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |