Recombinant Apoptin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7627P
Recombinant Apoptin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7627P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Chicken anemia virus |
Accession | Q99152 |
Synonym | VP3 |
Description | Recombinant Apoptin Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MNALQEDTPPGPSTVFRPPTSSRPLETPHCREIRIGIAGITITLSLCGCA NARAPTLRSATADNSESTGFKNVPDLRTDQPKPPSKKRSCDPSEYRVSEL KESLITTTPSRPRTAKRRIRL |
Molecular Weight | 40 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | May act as transcriptional regulator. Induces apoptosis in infected cells. Element of infectious replication cycle. |
Subcellular Location | Host nucleus. Note=Host nucleus of infected cells. |
Protein Families | Gyrovirus apoptin family |