Recombinant A. thaliana Osmotin like Protein OSM34 (His tag)
Beta LifeScience
SKU/CAT #: BLA-3512P
Recombinant A. thaliana Osmotin like Protein OSM34 (His tag)
Beta LifeScience
SKU/CAT #: BLA-3512P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Arabidopsis thaliana |
Accession | P50700 |
Synonym | OSL3_ARATH OSM34 Osmotin-like protein OSM34 |
Description | Recombinant A. thaliana Osmotin like Protein OSM34 (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNC NFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLV DGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQ YCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFC PRSRLGATGSHQLPIKMVTEEN |
Molecular Weight | 44 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |