Recombinant A. thaliana BAS1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3509P
Recombinant A. thaliana BAS1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3509P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Arabidopsis thaliana |
Accession | Q96291 |
Synonym | 2-Cys peroxiredoxin A 2-Cys peroxiredoxin BAS1 2-Cys Prx A BAS1 BAS1A_ARATH chloroplastic Thiol-specific antioxidant protein A |
Description | Recombinant A. thaliana BAS1 Protein (His tag) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDF TFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLG DLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLG IGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSA I |
Molecular Weight | 24 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. |
Subcellular Location | Plastid, chloroplast. |
Protein Families | Peroxiredoxin family, AhpC/Prx1 subfamily |
Database References |
Gene Functions References
- These quantitative data support a model where 2-CysPrx and Cyp20-3, by interaction, form a redox-sensitive regulatory module in the chloroplast which is under control of the photosynthesis-linked stromal pH value, the redox state and additional stromal protein factor(s).[2-CysPrx] PMID: 26872837
- Substitution of Cys for Ser at amino acid location 150 of the alpha-helix of 2-Cys Prx A regulates/enhances the dual peroxidase and chaperone enzymatic functions. [2-cysteine peroxiredoxin A] PMID: 26141131
- BAS1 and SOB7 act redundantly with respect to light promotion of cotyledon expansion, repression of hypocotyl elongation and flowering time in addition to other phenotypes not regulated by light. PMID: 15773851