Recombinant Rat Tpc1808 Protein
Beta LifeScience
SKU/CAT #: BL-4304PS
Recombinant Rat Tpc1808 Protein
Beta LifeScience
SKU/CAT #: BL-4304PS
Catalog No.: BL-4304PS
Product Overview
| Tag | N/A |
| Host Species | Rat |
| Synonym | Tropic 1808, Tpc1808. |
| Background | Tropic 1808 is a candidate chemotropic factor induced by nerve injury. Tpc1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. Tpc1808 is the gene related to promotion of nerve growth, and both the Tpc1808 gene and the Tpc1808 recombinant protein up-regulate the expression of NF-H in PC12 cells. |
| Description | Tropic-1808Rat Recombinant protein fused to N-terminal His-Tag expressed in E.Coli is a single, non-glycosylated polypeptide chain containing 285a.a. and having a molecular weight of 29.1 kDa.The Tpc1808 is purified by unique purification methods. |
| Source | E.coli |
| AA Sequence | MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS. |
| Purity | >95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Endotoxin | <1.0 EU per μg by the LAL method. |
| Formulation | The Tropic-1808 was lyophilized from 1X PBS, pH 7.4. |
| Stability | Recombinant protein is stable for 12 months at -70°C |
| Usage | For Research Use Only |
| Storage | Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C.Please prevent freeze-thaw cycles. |
