Recombinant Protein C (His tag)
Beta LifeScience
SKU/CAT #: BLA-7603P
Recombinant Protein C (His tag)
Beta LifeScience
SKU/CAT #: BLA-7603P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Accession | Q86132 |
Synonym | Activation peptide Anticoagulant protein C APC Autoprothrombin IIA Blood coagulation factor XIV EC 3.4.21.69 PC proC PROC_HUMAN PROC1 Protein C (inactivator of coagulation factors Va and VIIIa) THPH3 THPH4 Vitamin K dependent protein C |
Description | Recombinant Protein C (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MRSKHNELKSPIMSCSKRTEWKSILGPLIFRQQMILTQNLNQKLKTIKAC MYQIRKLSKLKALYRGL |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |