Recombinant Nicotinic Acetylcholine Receptor alpha 1/CHRNA1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10192P
Recombinant Nicotinic Acetylcholine Receptor alpha 1/CHRNA1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10192P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Accession | P02710 |
Synonym | Acetylcholine receptor subunit alpha ACHA_HUMAN AChR ACHRA ACHRD CHNRA Cholinergic receptor nicotinic alpha 1 subunit Cholinergic receptor nicotinic alpha polypeptide 1 Cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) Chrna1 CMS1A CMS1B CMS2A FCCMS Nicotinic cholinergic receptor alpha 1 SCCMS Schizophrenia neurophysiologic defect candidate |
Description | Recombinant Nicotinic Acetylcholine Receptor alpha 1/CHRNA1 Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIV ETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDF AIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWT YDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLD ITYHFIMQRI |
Molecular Weight | 41 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. |
Subcellular Location | Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. |
Protein Families | Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily |