Recombinant Mycobacterium tuberculosis TB Ag85A Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10187P
Recombinant Mycobacterium tuberculosis TB Ag85A Protein (His tag)

Recombinant Mycobacterium tuberculosis TB Ag85A Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-10187P
Catalog No.: BLA-10187P

Product Overview

Host Species Mycobacterium tuberculosis
Accession P9WQP2
Synonym 85 A 85A Ag85A Antigen 85 A Antigen 85 complex A Antigen 85A Fbp A FbpA Fibronectin binding protein A Mpt 44 Mpt44 Mycobacterium tuberculosis antigen 85A Mycolyl transferase 85 A Mycolyl transferase 85A Rv3804c Secreted antigen Ag85A
Description Recombinant Mycobacterium tuberculosis TB Ag85A Protein (His tag) was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFE WYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWL QANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAM GPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWV YCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDS GTHSWEYWGAQLNAMKPDLQRALGATPNT
Molecular Weight 34 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed