Recombinant Mycobacterium tuberculosis MPT64 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10180P
Recombinant Mycobacterium tuberculosis MPT64 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10180P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mycobacterium tuberculosis |
Accession | P9WIN8 |
Synonym | Antigen MPT64 immunogenic protein immunogenic protein Mpt64 mpb64 MT2032 MTCY39.39 Rv1980c simliar to Rv1980c of M. tuberculosis H37Rv |
Description | Recombinant Mycobacterium tuberculosis MPT64 Protein (His tag) was expressed in Baculovirus. It is a Protein fragment |
Source | Baculovirus |
AA Sequence | APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQT RDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGT HPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQ VSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAI DSMLA |
Molecular Weight | 25 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |