Name: Recombinant Mycobacterium tuberculosis Hypoxic response Protein 1 (Tagged)
Brand: Beta LifeScience
SKU: BLA-10177P
Availability: InStock

Recombinant Mycobacterium tuberculosis Hypoxic response Protein 1 (Tagged)

Catalog No.: BLA-10177P

Product Overview

Host Species	Mycobacterium tuberculosis
Accession	P9WJA3
Description	Recombinant Mycobacterium tuberculosis Hypoxic response Protein 1 (Tagged) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLT DRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVR RVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
Molecular Weight	36 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.