Name: Recombinant Mouse Von Willebrand Factor Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-10167P
Availability: InStock

Catalog No.: BLA-10167P

Host Species	Mouse
Accession	Q8CIZ8
Synonym	Coagulation factor VIII Coagulation factor VIII VWF F8VWF Factor VIII related antigen von Willebrand antigen 2 von Willebrand antigen II Von Willebrand disease Von Willebrand factor precursor VWD vWF VWF_HUMAN
Description	Recombinant Mouse Von Willebrand Factor Protein (Tagged) was expressed in E.coli. It is a Protein fragment
Source	E.coli
AA Sequence	DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVT MEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDR VEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIA PIFIRDFETLPREAPDLV
Molecular Weight	24 kDa including tags
Purity	>85% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.