Recombinant Mouse VISTA Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10163P
Recombinant Mouse VISTA Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10163P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9D659 |
Synonym | B7 H5 B7H5 C10orf54 chromosome 10 open reading frame 54 DD1alpha GI24 GI24_HUMAN PD-1H PDCD1 homolog Platelet receptor Gi24 PP2135 sisp 1 SISP1 stress induced secreted protein 1 UNQ730/PRO1412 V domain Ig suppressor of T cell activation V set domain containing immunoregulatory receptor V set immunoregulatory receptor V type immunoglobulin domain containing suppressor of T cell activation VISTA |
Description | Recombinant Mouse VISTA Protein (His tag) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQM CKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITL RNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNE QDSDSITAAHHHHHH |
Molecular Weight | 19 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. |