Recombinant Mouse VISTA Protein
Beta LifeScience
SKU/CAT #: BLA-10161P
Recombinant Mouse VISTA Protein
Beta LifeScience
SKU/CAT #: BLA-10161P
Catalog No.: BLA-10161P
Product Overview
| Host Species | Mouse |
| Accession | Q9D659 |
| Synonym | B7 H5 B7H5 C10orf54 chromosome 10 open reading frame 54 DD1alpha GI24 GI24_HUMAN PD-1H PDCD1 homolog Platelet receptor Gi24 PP2135 sisp 1 SISP1 stress induced secreted protein 1 UNQ730/PRO1412 V domain Ig suppressor of T cell activation V set domain containing immunoregulatory receptor V set immunoregulatory receptor V type immunoglobulin domain containing suppressor of T cell activation VISTA |
| Description | Recombinant Mouse VISTA Protein was expressed in Insect cells. It is a Protein fragment |
| Source | Insect cells |
| AA Sequence | FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQM CKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITL RNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNE QDSDSITAALEHHHHHH |
| Molecular Weight | 19 kDa |
| Purity | >90% purity as determined by SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |
