Recombinant Mouse Urokinase Protein
Beta LifeScience
SKU/CAT #: BLA-10156P

Recombinant Mouse Urokinase Protein
Beta LifeScience
SKU/CAT #: BLA-10156P
Catalog No.: BLA-10156P
Product Overview
Host Species | Mouse |
Synonym | ATF ATF uPA BDPLT5 Plasminogen activator Plasminogen activator urinary Plasminogen activator urokinase PLAU QPD u PA U plasminogen activator u-PA U-plasminogen activator uPA URK UROK_HUMAN Urokinase plasminogen activator Urokinase type plasminogen activator Urokinase type plasminogen activator precursor Urokinase-type plasminogen activator chain B |
Description | Recombinant Mouse Urokinase Protein was expressed in Insect cells. It is a Full length protein |
Source | Insect cells |
AA Sequence | KKPSSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQKNKGGS PPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVYLGQSKESSYNPGEMK FEVEQLILHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTICLPPR FTDAPFGSDCEITGFGKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGS |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |