Recombinant Mouse Urokinase Protein (Biotin)
Beta LifeScience
SKU/CAT #: BLA-10157P
Recombinant Mouse Urokinase Protein (Biotin)
Beta LifeScience
SKU/CAT #: BLA-10157P
Catalog No.: BLA-10157P
Product Overview
| Host Species | Mouse |
| Synonym | ATF ATF uPA BDPLT5 Plasminogen activator Plasminogen activator urinary Plasminogen activator urokinase PLAU QPD u PA U plasminogen activator u-PA U-plasminogen activator uPA URK UROK_HUMAN Urokinase plasminogen activator Urokinase type plasminogen activator Urokinase type plasminogen activator precursor Urokinase-type plasminogen activator chain B |
| Description | Recombinant Mouse Urokinase Protein (Biotin) was expressed in Insect cells. It is a Full length protein |
| Source | Insect cells |
| AA Sequence | MKVWLASLFLCALVVKNSEGGSVLGAPDESNCGCQNGGVCVSYKYFSRIR RCSCPRKFQGEHCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAV LQKPYNAHRPDAISLGLGKHNYCRNPDNQKRPWCYVQIGLRQFVQECMVH DCSLSKKPSSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQK |
| Purity | >95% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
