Recombinant Mouse TWEAKR/FN14 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10151P
Recombinant Mouse TWEAKR/FN14 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-10151P
Catalog No.: BLA-10151P
Product Overview
| Host Species | Mouse |
| Accession | Q9CR75 |
| Synonym | CD 266 CD266 CD266 antigen FGF inducible 14 FGF-inducible 14 Fibroblast growth factor inducible immediate early response protein 14 Fibroblast growth factor-inducible immediate-early response protein 14 FN 14 FN14 TNFRSF 12A TNFRSF12A TNR12_HUMAN Tumor necrosis factor receptor superfamily member 12A TWEAK R Tweak receptor Tweak-receptor TweakR |
| Description | Recombinant Mouse TWEAKR/FN14 Protein (Fc Tag) was expressed in Mammalian. It is a Protein fragment |
| Source | Mammalian |
| AA Sequence | EQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRL LWVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Molecular Weight | 33 kDa including tags |
| Purity | Greater than 95% SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
