Name: Recombinant Mouse TWEAKR/FN14 Protein
Brand: Beta LifeScience
SKU: BLA-10150P
Availability: InStock

Catalog No.: BLA-10150P

Host Species	Mouse
Accession	Q9CR75
Synonym	CD 266 CD266 CD266 antigen FGF inducible 14 FGF-inducible 14 Fibroblast growth factor inducible immediate early response protein 14 Fibroblast growth factor-inducible immediate-early response protein 14 FN 14 FN14 TNFRSF 12A TNFRSF12A TNR12_HUMAN Tumor necrosis factor receptor superfamily member 12A TWEAK R Tweak receptor Tweak-receptor TweakR
Description	Recombinant Mouse TWEAKR/FN14 Protein was expressed in HEK293. It is a Protein fragment
Source	HEK293
AA Sequence	MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCM DCASCPARPHSDFCLGCAAAPPAHF
Molecular Weight	34 kDa
Purity	>95% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Binds Human and mouse TWEAK.Inhibits TWEAK-mediated killing of Kym-1 target cells.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C.