Recombinant Mouse TrkB Protein
Beta LifeScience
SKU/CAT #: BLA-10146P
Recombinant Mouse TrkB Protein
Beta LifeScience
SKU/CAT #: BLA-10146P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P15209 |
Synonym | AI848316 BDNF tropomyosine receptor kinase B BDNF/NT 3 growth factors receptor BDNF/NT-3 growth factors receptor Brain derived neurotrophic factor receptor C030027L06Rik EC 2.7.10.1 GP145 TrkB GP145-TrkB GP145-TrkB/GP95-TrkB GP95 TrkB Neurotrophic receptor tyrosine kinase 2 Neurotrophic tyrosine kinase receptor type 2 Neurotrophin receptor tyrosine kinase type 2 NTRK 2 Ntrk2 NTRK2_HUMAN Obesity, hyperphagia, and developmental delay, included RATTRKB1 Tkrb Trk B Trk-B TRKB TrkB tyrosine kinase TRKB1 Tropomyosin related kinase B tyrosine kinase receptor B Tyrosine receptor kinase B |
Description | Recombinant Mouse TrkB Protein was expressed in Insect cells. It is a Protein fragment |
Source | Insect cells |
AA Sequence | CPTSCKCSSARIWCTEPSPGIVAFPRLEPNSVDPENITEILIANQKRLEI INEDDVEAYVGLRNLTIVDSGLKFVAYKAFLKNSNLRHINFTRNKLTSLS RRHFRHLDLSDLILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNESS KNMPLANLQIPNCGLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWD VGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNL TVHFAPTITFLESPTSDHHWCIPFTVRGNPKPALQWFYNGAILNESKYIC TKIHVTNHTEYHGCLQLDNPTHMNNGDYTLMAKNEYGKDERQISAHFMGR PGVDYETNPNYPEVLYEDWTTPTDIGDTTNKSNEIPSTDVADQSNREHAA ALEHHHHHH |
Molecular Weight | 46 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |