Name: Recombinant Mouse TREM2 Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-10145P
Availability: InStock

Catalog No.: BLA-10145P

Host Species	Mouse
Accession	Q99NH8
Synonym	TREM 2 TREM-2 TREM2 TREM2_HUMAN TREM2a TREM2b TREM2c Trggering receptor expressed on myeloid cells 2 Trggering receptor expressed on myeloid cells 2a Triggering receptor expressed on monocytes 2 Triggering receptor expressed on myeloid cells 2
Description	Recombinant Mouse TREM2 Protein (His tag) was expressed in Mammalian. It is a Protein fragment
Source	Mammalian
AA Sequence	LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHG VWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREA EVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFP PTS
Molecular Weight	21 kDa including tags
Purity	>90% by SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.