Recombinant Mouse TMPRSS4 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-10134P

Recombinant Mouse TMPRSS4 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-10134P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Mouse
Accession Q8VCA5
Synonym UNQ776/PRO1570 CAPH2 Channel-activating protease 2 Membrane type serine protease 2 Membrane-type serine protease 2 MT SP2 MT-SP2 TMPRSS 4 TMPRSS3 TMPRSS4 TMPS4_HUMAN Transmembrane protease serine 4 Transmembrane protease, serine 4 Transmembrane serine protease 3
Description Recombinant Mouse TMPRSS4 Protein (Tagged) was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVA VRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRA VEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTP RVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDV SSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFS GSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDS TRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGI VSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM
Molecular Weight 58 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Plasma membrane-anchored serine protease that directly induces processing of pro-uPA/PLAU into the active form through proteolytic activity. Seems to be capable of activating ENaC.
Subcellular Location Cell membrane; Single-pass type II membrane protein.; [Transmembrane protease serine 4 catalytic chain]: Secreted.
Protein Families Peptidase S1 family
Database References

Gene Functions References

  1. The lung fibrotic response evaluated at 28 days after bleomycin injury was markedly attenuated in the haplodeficient and deficient TMPRSS4 mice. PMID: 29529050
  2. Epithelial Sodium Channel-Mediated Sodium Transport Is Not Dependent on the Membrane-Bound Serine Protease CAP2/Tmprss4 PMID: 26309024
  3. Progression and metastatic potential of several cancers is concordant with an increased expression of TMPRSS4. PMID: 22944691
  4. TMPRSS4 primarily activates ENaC by cleaving basic residues within the tract gammaK173-K186 distal to the furin cleavage site, thereby releasing a previously defined key inhibitory tract encompassing gammaR158-F168 from the gamma-subunit. PMID: 21993886

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed